PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31620.1
Common NameF28M20.190, REM3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 492aa    MW: 55712.1 Da    PI: 10.0396
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.74.9e-142097993
                 HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                  ++ +++l++p +f+++h +gk ++ ++l+l++  s r W+v+l  ++++    +++GW +F  a+ L++ D++vF+ld ++ f  +
  AT4G31620.1 20 LAGHTSNLIIPDEFFTAHlEGK-TGLTKLKLTSdASDRIWDVRL--NGRR----FAGGWDDFSAAHCLRDDDVLVFRLDVKMVF--H 97
                 5566778***********6555.67789999987899*******..8887....99*********************9865666..4 PP

2B356.74.3e-18160248797
                  .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++++l+++r+++ k+f +++g+ k++  ++ l+++sg+sW++ l+++k+ g+ ++++ W++F++an+Lk g f  Fkl++ ++++++++++
  AT4G31620.1 160 TASNLRLNRVSFTKHFSRANGLTKRCC-MIDLMNLSGESWTLGLRHNKRTGQAFIRGRWRSFCHANELKPGSFYRFKLVR-NGTRPLLQLC 248
                  6789999****************9886.**************************************************98.6677888877 PP

3B371.31.3e-22286382199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  f++v++++++ +sg+l+l ++f++e+g+k++e  +++l d++g +W  +++ +k++++++++ GW +F++an+Lk+g+++++++++ +++++++k+++
  AT4G31620.1 286 FLTVTLKHYMIQSGQLRLRRSFVRENGIKEAE--EIILVDKNGVEWPSYVSSSKQRREFYMAHGWIRFCEANKLKTGETFTLEFVRGEGTTPMLKFCS 381
                  7889999********************99766..8***************999**999***************************99*********98 PP

                  S CS
           B3  99 k 99 
                  +
  AT4G31620.1 382 E 382
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.3E-167100IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-158102IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.37812104IPR003340B3 DNA binding domain
CDDcd100171.73E-131499No hitNo description
SMARTSM010193.9E-1816104IPR003340B3 DNA binding domain
PfamPF023626.3E-91892IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.7E-17147248IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.71E-16152251IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.1E-24154251IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899154250IPR003340B3 DNA binding domain
PfamPF023624.6E-17159248IPR003340B3 DNA binding domain
CDDcd100171.56E-18159248No hitNo description
Gene3DG3DSA:2.40.330.105.4E-20279382IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.65E-20283381IPR015300DNA-binding pseudobarrel domain
CDDcd100174.77E-16286373No hitNo description
PfamPF023623.3E-22286382IPR003340B3 DNA binding domain
PROSITE profilePS5086314.113286382IPR003340B3 DNA binding domain
SMARTSM010197.9E-30286383IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MANHPLSSSR SNRPFFVRSL AGHTSNLIIP DEFFTAHLEG KTGLTKLKLT SDASDRIWDV  60
RLNGRRFAGG WDDFSAAHCL RDDDVLVFRL DVKMVFHVTP SGRSFSQIRT SSSSGDYDSD  120
DDDDEAGDDD SDSKNISLKK KSRFEAESSS SEKYCLLGLT ASNLRLNRVS FTKHFSRANG  180
LTKRCCMIDL MNLSGESWTL GLRHNKRTGQ AFIRGRWRSF CHANELKPGS FYRFKLVRNG  240
TRPLLQLCFK VIPQGNCSNS KANGKANVSE KYSREDGSAS TKQNKFLTVT LKHYMIQSGQ  300
LRLRRSFVRE NGIKEAEEII LVDKNGVEWP SYVSSSKQRR EFYMAHGWIR FCEANKLKTG  360
ETFTLEFVRG EGTTPMLKFC SEAKIEQEEA PEERGTPLPK RARVSAEVGH SRRTQAPNKS  420
SDDPKILQRK QPLQPCSFSD QAKKVKQSIV NILTGIKRFR SELELKERNL EAALLEIDAL  480
GDKVSEINKI LK
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253540_at3e-37
Expression AtlasAT4G31620-
AtGenExpressAT4G31620-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0639300.0AY063930.1 Arabidopsis thaliana unknown protein (At4g31620) mRNA, complete cds.
GenBankAY1337530.0AY133753.1 Arabidopsis thaliana clone U18158 unknown protein (At4g31620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194890.20.0transcriptional factor B3 family protein
SwissprotQ8VZQ90.0REM3_ARATH; B3 domain-containing protein REM3
TrEMBLG0XQD30.0G0XQD3_ARATH; Transcriptional factor B3 family protein
STRINGAT4G31620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]